Description
Description
Acylated Amylin Analogue (Cagrilintide) is a synthetically manufactured, highly purified peptide designed to function as a long-acting, non-selective agonist at both amylin receptors (AMYR) and calcitonin G-protein coupled receptors (CTR). This engineered compound features an optimized 38-amino-acid backbone acylated with an eicosanedioic acid fatty chain via a gamma-glutamic acid spacer. This precise lipidation structure modifies clearance rates and extends metabolic stability, providing an advanced laboratory medium for investigating central neurochemical signaling pathways, comparative binding kinetics, homeostatic energy expenditure, and synergistic co-agonist behavior when evaluated alongside GLP-1 or glucagon pathway receptors in in vitro research models. Our reagent is synthesized utilizing advanced solid-phase peptide synthesis (SPPS) methodologies and high-performance liquid chromatography (HPLC) purification protocols, yielding a pristine, highly stable lyophilized white crystalline powder cake optimized for chemical consistency, structural longevity, and reproducible results across high-throughput analytical screening.
Acylated Amylin Analogue (Cagrilintide) is a synthetically manufactured, highly purified peptide designed to function as a long-acting, non-selective agonist at both amylin receptors (AMYR) and calcitonin G-protein coupled receptors (CTR). This engineered compound features an optimized 38-amino-acid backbone acylated with an eicosanedioic acid fatty chain via a gamma-glutamic acid spacer. This precise lipidation structure modifies clearance rates and extends metabolic stability, providing an advanced laboratory medium for investigating central neurochemical signaling pathways, comparative binding kinetics, homeostatic energy expenditure, and synergistic co-agonist behavior when evaluated alongside GLP-1 or glucagon pathway receptors in in vitro research models. Our reagent is synthesized utilizing advanced solid-phase peptide synthesis (SPPS) methodologies and high-performance liquid chromatography (HPLC) purification protocols, yielding a pristine, highly stable lyophilized white crystalline powder cake optimized for chemical consistency, structural longevity, and reproducible results across high-throughput analytical screening.
Product Specifications
-
- Compound Name: Acylated Amylin Analogue (Cagrilintide)
- Sequence Matrix: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge: Cys3-Cys8)
- Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
- Molecular Weight: 4409.01 g/mol
- CAS Registry Number: 1415456-99-3
- Physical Form: Lyophilized Crystalline Powder
- Purity Matrix: >99.0% (Verified via HPLC & Mass Spectrometry)
- Source: Formulated, Inspected, and Distributed in the USA
- Packaging: Single vacuum-sealed glass vial (3mL configuration) available in multiple certified mass variations.
Laboratory Storage & Handling Parameters
-
- Lyophilized Storage: To maintain optimal structural integrity and prevent natural peptide degradation, store the dry powder cake continuously frozen at or below -20°C prior to evaluation. Stable under properly desiccated conditions for up to 24 months from the manufacturing date.
- Solvent Compatibility: This reagent is structurally evaluated for dissolution testing utilizing standard laboratory solvents, such as sterile Bacteriostatic Water (0.9% Benzyl Alcohol) or sterile 0.9% Sodium Chloride.
- Post-Solvent Stability: Once a liquid phase is introduced for analytical evaluation, the compound must be maintained under continuous refrigeration between 2°C and 8°C (36°F to 46°F) and completely protected from prolonged exposure to direct light or ambient UV radiation.
Regulatory & Safety Disclosure
LABORATORY RESEARCH USE ONLY. This synthesized product is a purified chemical reagent intended exclusively for in vitro scientific research, biochemical analysis, and forensic evaluation. It is strictly NOT FOR HUMAN CONSUMPTION, therapeutic administration, weight management or lifestyle tracking, clinical trials, medical diagnosis, veterinary application, or domestic diagnostic applications. This material must be handled exclusively by qualified, trained laboratory personnel utilizing appropriate personal protective equipment (PPE) inside an authorized testing environment.
LABORATORY RESEARCH USE ONLY. This synthesized product is a purified chemical reagent intended exclusively for in vitro scientific research, biochemical analysis, and forensic evaluation. It is strictly NOT FOR HUMAN CONSUMPTION, therapeutic administration, weight management or lifestyle tracking, clinical trials, medical diagnosis, veterinary application, or domestic diagnostic applications. This material must be handled exclusively by qualified, trained laboratory personnel utilizing appropriate personal protective equipment (PPE) inside an authorized testing environment.
Reviews
There are no reviews yet.